Lineage for d1kkcx1 (1kkc X:15-97)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94371Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 94462Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 94463Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 94532Protein Mn superoxide dismutase (MnSOD) [46618] (4 species)
  7. 94533Species Aspergillus fumigatus [TaxId:5085] [68944] (1 PDB entry)
  8. 94536Domain d1kkcx1: 1kkc X:15-97 [68664]
    Other proteins in same PDB: d1kkca2, d1kkcb2, d1kkcx2, d1kkcy2

Details for d1kkcx1

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD

SCOP Domain Sequences for d1kkcx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcx1 a.2.11.1 (X:15-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus}
qytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvsv
qqaikfnggghinhslfwknlap

SCOP Domain Coordinates for d1kkcx1:

Click to download the PDB-style file with coordinates for d1kkcx1.
(The format of our PDB-style files is described here.)

Timeline for d1kkcx1: