SCOPe 2.06: Domain d1kkcb2: 1kkc B:98-213

Lineage for d1kkcb2 (1kkc B:98-213)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry)

8. Domain d1kkcb2: 1kkc B:98-213 [68663]
   Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1
   complexed with mn

Details for d1kkcb2

PDB Entry: 1kkc, 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD

PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1kkcb2:

Sequence; same for both SEQRES and ATOM records:

>d1kkcb2 d.44.1.1 (B:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]}
eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt
thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdk

Timeline for d1kkcb2:

• d1kkcb2 first appeared in SCOP 1.59
  
• d1kkcb2 appears in SCOPe 2.05
  
• d1kkcb2 appears in SCOPe 2.07
  
• d1kkcb2 appears in the current release, SCOPe 2.08