Lineage for d1kkcb2 (1kkc B:98-213)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024908Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1024909Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 1024910Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 1025036Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 1025040Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry)
  8. 1025042Domain d1kkcb2: 1kkc B:98-213 [68663]
    Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1
    complexed with mn

Details for d1kkcb2

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD
PDB Compounds: (B:) manganese superoxide dismutase

SCOPe Domain Sequences for d1kkcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcb2 d.44.1.1 (B:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]}
eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt
thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdk

SCOPe Domain Coordinates for d1kkcb2:

Click to download the PDB-style file with coordinates for d1kkcb2.
(The format of our PDB-style files is described here.)

Timeline for d1kkcb2: