Lineage for d1kk6b_ (1kk6 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809516Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 809517Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 809539Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 809559Protein Xenobiotic acetyltransferase [51169] (2 species)
  7. 809560Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (7 PDB entries)
    streptogramin A acetyltransferase
  8. 809568Domain d1kk6b_: 1kk6 B: [68658]

Details for d1kk6b_

PDB Entry: 1kk6 (more details), 2.5 Å

PDB Description: crystal structure of vat(d) (form i)
PDB Compounds: (B:) streptogramin a acetyltransferase

SCOP Domain Sequences for d1kk6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk6b_ b.81.1.3 (B:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiireviw

SCOP Domain Coordinates for d1kk6b_:

Click to download the PDB-style file with coordinates for d1kk6b_.
(The format of our PDB-style files is described here.)

Timeline for d1kk6b_: