Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein Xenobiotic acetyltransferase [51169] (2 species) |
Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (7 PDB entries) streptogramin A acetyltransferase |
Domain d1kk6b_: 1kk6 B: [68658] |
PDB Entry: 1kk6 (more details), 2.5 Å
SCOP Domain Sequences for d1kk6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kk6b_ b.81.1.3 (B:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik wwnwpidiinenidkildnsiireviw
Timeline for d1kk6b_: