SCOP 1.75: Domain d1kk4f_: 1kk4 F:

Lineage for d1kk4f_ (1kk4 F:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (3 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein Xenobiotic acetyltransferase [51169] (2 species)

7. Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (7 PDB entries)
   streptogramin A acetyltransferase

8. Domain d1kk4f_: 1kk4 F: [68650]
   complexed with aco

Details for d1kk4f_

PDB Entry: 1kk4, 2.7 Å

PDB Description: crystal structure of vat(d) in complex with acetyl-coa

PDB Compounds: (F:) streptogramin a acetyltransferase

SCOP Domain Sequences for d1kk4f_:

Sequence; same for both SEQRES and ATOM records:

>d1kk4f_ b.81.1.3 (F:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiirevi

Timeline for d1kk4f_:

• d1kk4f_ first appeared in SCOP 1.59
  
• d1kk4f_ appears in SCOP 1.73
  
• d1kk4f_ appears in SCOPe 2.01
  
• d1kk4f_ appears in the current release, SCOPe 2.08