Lineage for d1kk4a_ (1kk4 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1329988Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 1330008Protein Xenobiotic acetyltransferase [51169] (2 species)
  7. 1330009Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (8 PDB entries)
    streptogramin A acetyltransferase
  8. 1330031Domain d1kk4a_: 1kk4 A: [68645]
    complexed with aco

Details for d1kk4a_

PDB Entry: 1kk4 (more details), 2.7 Å

PDB Description: crystal structure of vat(d) in complex with acetyl-coa
PDB Compounds: (A:) streptogramin a acetyltransferase

SCOPe Domain Sequences for d1kk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kk4a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiirev

SCOPe Domain Coordinates for d1kk4a_:

Click to download the PDB-style file with coordinates for d1kk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1kk4a_: