Lineage for d1kjwa2 (1kjw A:526-724)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474226Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species)
  7. 2474227Species Norway rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries)
  8. 2474228Domain d1kjwa2: 1kjw A:526-724 [68644]
    Other proteins in same PDB: d1kjwa1
    complexed with so4

Details for d1kjwa2

PDB Entry: 1kjw (more details), 1.8 Å

PDB Description: sh3-guanylate kinase module from psd-95
PDB Compounds: (A:) postsynaptic density protein 95

SCOPe Domain Sequences for d1kjwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss
rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp
iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk
rviedlsgpyiwvparerl

SCOPe Domain Coordinates for d1kjwa2:

Click to download the PDB-style file with coordinates for d1kjwa2.
(The format of our PDB-style files is described here.)

Timeline for d1kjwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjwa1