SCOPe 2.06: Domain d1kjwa2: 1kjw A:526-724

Lineage for d1kjwa2 (1kjw A:526-724)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries)

8. Domain d1kjwa2: 1kjw A:526-724 [68644]
   Other proteins in same PDB: d1kjwa1
   complexed with so4

Details for d1kjwa2

PDB Entry: 1kjw, 1.8 Å

PDB Description: sh3-guanylate kinase module from psd-95

PDB Compounds: (A:) postsynaptic density protein 95

SCOPe Domain Sequences for d1kjwa2:

Sequence; same for both SEQRES and ATOM records:

>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss
rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp
iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk
rviedlsgpyiwvparerl

Timeline for d1kjwa2:

• d1kjwa2 first appeared in SCOP 1.59
  
• d1kjwa2 appears in SCOPe 2.05
  
• d1kjwa2 appears in SCOPe 2.07
  
• d1kjwa2 appears in the current release, SCOPe 2.08