Lineage for d1kjwa2 (1kjw A:526-724)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) 
Protein Guanylate kinase-like domain of Psd-95 [69476] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69477] (3 PDB entries) 
Domain d1kjwa2: 1kjw A:526-724 [68644]
Other proteins in same PDB: d1kjwa1
Details for d1kjwa2
PDB Entry: 1kjw (more details), 1.8 Å
PDB Description: sh3-guanylate kinase module from psd-95
SCOP Domain Sequences for d1kjwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus)}
vtqmevhyarpiiilgptkdranddllsefpdkfgscvphttrpkreyeidgrdyhfvss
rekmekdiqahkfieagqynshlygtsvqsvrevaeqgkhcildvsanavrrlqaahlhp
iaifirprslenvleinkriteeqarkafdratkleqeftecfsaivegdsfeeiyhkvk
rviedlsgpyiwvparerl
SCOP Domain Coordinates for d1kjwa2:
Click to download the PDB-style file with coordinates for d1kjwa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kjwa2:
- d1kjwa2 is new in SCOP 1.59
- d1kjwa2 appears in SCOP 1.61
- d1kjwa2 appears in the current release, SCOPe 2.08
View in 3D
