Lineage for d1kixa3 (1kix A:329-495)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110612Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 110651Protein Telomere end binding protein alpha subunit [50273] (1 species)
  7. 110652Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)
  8. 110658Domain d1kixa3: 1kix A:329-495 [68636]

Details for d1kixa3

PDB Entry: 1kix (more details), 2.7 Å

PDB Description: Dimeric Structure of the O. nova Telomere End Binding Protein Alpha Subunit with Bound ssDNA

SCOP Domain Sequences for d1kixa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kixa3 b.40.4.3 (A:329-495) Telomere end binding protein alpha subunit {Oxytricha nova}
slnavvltevdkkhaalpstslqdlfhhadsdkelqaqdtfrtqfyvtkiepsdvkewvk
gydrktkkssslkgasgkgdnifqvqflvkdastqlnnntyrvllytqdglganffnvka
dnlhknadarkkledsaelltkfnsyvdavverrngfylikdtkliy

SCOP Domain Coordinates for d1kixa3:

Click to download the PDB-style file with coordinates for d1kixa3.
(The format of our PDB-style files is described here.)

Timeline for d1kixa3: