Lineage for d1khxa_ (1khx A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) 
Family b.26.1.1: SMAD domain [49880] (3 proteins) Protein Smad2 MH2 domain [49883] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49884] (2 PDB entries) 
Domain d1khxa_: 1khx A: [68631]
Details for d1khxa_
PDB Entry: 1khx (more details), 1.8 Å
PDB Description: Crystal structure of a phosphorylated Smad2
SCOP Domain Sequences for d1khxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khxa_ b.26.1.1 (A:) Smad2 MH2 domain {Human (Homo sapiens)}
pvtysepafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnat
vemtrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlki
fnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlng
plqwldkvltqmgspsvrcssms
SCOP Domain Coordinates for d1khxa_:
Click to download the PDB-style file with coordinates for d1khxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khxa_:
- d1khxa_ is new in SCOP 1.59
- d1khxa_ appears in SCOP 1.61
- d1khxa_ appears in the current release, SCOPe 2.08
View in 3D