Lineage for d1khud_ (1khu D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164426Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
  4. 164427Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) (S)
  5. 164428Family b.26.1.1: SMAD domain [49880] (3 proteins)
  6. 164429Protein Smad1 [69233] (1 species)
  7. 164430Species Human (Homo sapiens) [TaxId:9606] [69234] (1 PDB entry)
  8. 164434Domain d1khud_: 1khu D: [68626]

Details for d1khud_

PDB Entry: 1khu (more details), 2.5 Å

PDB Description: Smad1 crystal structure reveals the details of BMP signaling pathway

SCOP Domain Sequences for d1khud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khud_ b.26.1.1 (D:) Smad1 {Human (Homo sapiens)}
hwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrrh
igkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqefa
qllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwldk
vltq

SCOP Domain Coordinates for d1khud_:

Click to download the PDB-style file with coordinates for d1khud_.
(The format of our PDB-style files is described here.)

Timeline for d1khud_: