Lineage for d1khud_ (1khu D:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) 
Family b.26.1.1: SMAD domain [49880] (3 proteins) 
Protein Smad1 [69233] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69234] (1 PDB entry) 
Domain d1khud_: 1khu D: [68626]
Details for d1khud_
PDB Entry: 1khu (more details), 2.5 Å
PDB Description: Smad1 crystal structure reveals the details of BMP signaling pathway
SCOP Domain Sequences for d1khud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khud_ b.26.1.1 (D:) Smad1 {Human (Homo sapiens)}
hwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrrh
igkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqefa
qllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwldk
vltq
SCOP Domain Coordinates for d1khud_:
Click to download the PDB-style file with coordinates for d1khud_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khud_:
- d1khud_ is new in SCOP 1.59
- d1khud_ appears in SCOP 1.61
- d1khud_ appears in the current release, SCOPe 2.08
View in 3D
