SCOPe 2.05: Domain d1khub_: 1khu B:

Lineage for d1khub_ (1khu B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.1: SMAD domain [49880] (4 proteins)

6. Protein Smad1 [69233] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69234] (1 PDB entry)

8. Domain d1khub_: 1khu B: [68624]

Details for d1khub_

PDB Entry: 1khu, 2.5 Å

PDB Description: Smad1 crystal structure reveals the details of BMP signaling pathway

PDB Compounds: (B:) smad1

SCOPe Domain Sequences for d1khub_:

Sequence; same for both SEQRES and ATOM records:

>d1khub_ b.26.1.1 (B:) Smad1 {Human (Homo sapiens) [TaxId: 9606]}
khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
kvltqmgsphnpissvs

Timeline for d1khub_:

• d1khub_ first appeared in SCOP 1.59
  
• d1khub_ appears in SCOPe 2.04
  
• d1khub_ appears in SCOPe 2.06
  
• d1khub_ appears in the current release, SCOPe 2.08