Lineage for d1khub_ (1khu B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108433Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
  4. 108434Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) (S)
  5. 108435Family b.26.1.1: SMAD domain [49880] (3 proteins)
  6. 108436Protein Smad1 [69233] (1 species)
  7. 108437Species Human (Homo sapiens) [TaxId:9606] [69234] (1 PDB entry)
  8. 108439Domain d1khub_: 1khu B: [68624]

Details for d1khub_

PDB Entry: 1khu (more details), 2.5 Å

PDB Description: Smad1 crystal structure reveals the details of BMP signaling pathway

SCOP Domain Sequences for d1khub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khub_ b.26.1.1 (B:) Smad1 {Human (Homo sapiens)}
khwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrr
higkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqef
aqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwld
kvltqmgsphnpissvs

SCOP Domain Coordinates for d1khub_:

Click to download the PDB-style file with coordinates for d1khub_.
(The format of our PDB-style files is described here.)

Timeline for d1khub_: