Lineage for d1khrb_ (1khr B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115031Fold b.81: Single-stranded left-handed beta-helix [51160] (2 superfamilies)
  4. 115032Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (5 families) (S)
  5. 115045Family b.81.1.3: Xenobiotic acetyltransferase [51168] (1 protein)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 115046Protein Xenobiotic acetyltransferase [51169] (2 species)
  7. 115047Species Enterococcus faecium, VAT(D) [TaxId:1352] [69344] (4 PDB entries)
  8. 115052Domain d1khrb_: 1khr B: [68618]

Details for d1khrb_

PDB Entry: 1khr (more details), 2.8 Å

PDB Description: crystal structure of vat(d) in complex with virginiamycin and coenzyme a

SCOP Domain Sequences for d1khrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khrb_ b.81.1.3 (B:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D)}
mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
wwnwpidiinenidkildnsiirev

SCOP Domain Coordinates for d1khrb_:

Click to download the PDB-style file with coordinates for d1khrb_.
(The format of our PDB-style files is described here.)

Timeline for d1khrb_: