Lineage for d1khha_ (1khh A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125563Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 125564Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (18 families) (S)
  5. 125721Family c.66.1.16: Guanidinoacetate methyltransferase [69550] (1 protein)
  6. 125722Protein Guanidinoacetate methyltransferase [69551] (1 species)
  7. 125723Species Rat (Rattus norvegicus) [TaxId:10116] [69552] (1 PDB entry)
  8. 125724Domain d1khha_: 1khh A: [68615]

Details for d1khha_

PDB Entry: 1khh (more details), 2.5 Å

PDB Description: crystal structure of guanidinoacetate methyltransferase from rat liver: a template structure of protein arginine methyltransferase

SCOP Domain Sequences for d1khha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khha_ c.66.1.16 (A:) Guanidinoacetate methyltransferase {Rat (Rattus norvegicus)}
rwetpymhslaaaaasrggrvlevgfgmaiaasrvqqapikehwiiecndgvfqrlqnwa
lkqphkvvplkglweevaptlpdghfdgilydtyplseetwhthqfnfikthafrllkpg
giltycnltswgelmkskytditamfeetqvpalleagfqrenictevmalvppadcryy
afpqmitplvtkh

SCOP Domain Coordinates for d1khha_:

Click to download the PDB-style file with coordinates for d1khha_.
(The format of our PDB-style files is described here.)

Timeline for d1khha_: