Lineage for d1khfa2 (1khf A:10-259)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1011363Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 1011364Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 1011365Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 1011366Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species)
  7. 1011367Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 1011370Domain d1khfa2: 1khf A:10-259 [68612]
    Other proteins in same PDB: d1khfa1
    complexed with edo, mn, na, pep

Details for d1khfa2

PDB Entry: 1khf (more details), 2.02 Å

PDB Description: pepck complex with pep
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic (GTP)

SCOPe Domain Sequences for d1khfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khfa2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOPe Domain Coordinates for d1khfa2:

Click to download the PDB-style file with coordinates for d1khfa2.
(The format of our PDB-style files is described here.)

Timeline for d1khfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khfa1