Lineage for d1khfa2 (1khf A:10-259)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496025Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 496026Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 496027Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 496028Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species)
  7. 496029Species Human (Homo sapiens) [TaxId:9606] [69616] (6 PDB entries)
  8. 496032Domain d1khfa2: 1khf A:10-259 [68612]
    Other proteins in same PDB: d1khfa1

Details for d1khfa2

PDB Entry: 1khf (more details), 2.02 Å

PDB Description: pepck complex with pep

SCOP Domain Sequences for d1khfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khfa2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens)}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOP Domain Coordinates for d1khfa2:

Click to download the PDB-style file with coordinates for d1khfa2.
(The format of our PDB-style files is described here.)

Timeline for d1khfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khfa1