Lineage for d1khea2 (1khe A:10-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2527952Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2527953Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2527954Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2527955Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species)
  7. 2527956Species Human (Homo sapiens) [TaxId:9606] [69616] (7 PDB entries)
  8. 2527964Domain d1khea2: 1khe A:10-259 [68610]
    Other proteins in same PDB: d1khea1
    complexed with gcp, mn

Details for d1khea2

PDB Entry: 1khe (more details), 2.4 Å

PDB Description: pepck complex with nonhydrolyzable gtp analog, mad data
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic (GTP)

SCOPe Domain Sequences for d1khea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khea2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOPe Domain Coordinates for d1khea2:

Click to download the PDB-style file with coordinates for d1khea2.
(The format of our PDB-style files is described here.)

Timeline for d1khea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khea1