Lineage for d1khea2 (1khe A:10-259)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) 
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) 
Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolysing) [69615] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69616] (4 PDB entries) 
Domain d1khea2: 1khe A:10-259 [68610]
Other proteins in same PDB: d1khea1
Details for d1khea2
PDB Entry: 1khe (more details), 2.4 Å
PDB Description: pepck complex with nonhydrolyzable gtp analog, mad data
SCOP Domain Sequences for d1khea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khea2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolysing) {Human (Homo sapiens)}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg
SCOP Domain Coordinates for d1khea2:
Click to download the PDB-style file with coordinates for d1khea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khea2:
- d1khea2 is new in SCOP 1.59
- d1khea2 appears in SCOP 1.61
- d1khea2 appears in the current release, SCOPe 2.08
View in 3D
