Lineage for d1khca_ (1khc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394295Protein DNA methyltransferase DNMT3B [69251] (2 species)
  7. 2394298Species Mouse (Mus musculus) [TaxId:10090] [69252] (1 PDB entry)
  8. 2394299Domain d1khca_: 1khc A: [68608]
    complexed with unx

Details for d1khca_

PDB Entry: 1khc (more details), 1.8 Å

PDB Description: Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b
PDB Compounds: (A:) DNA cytosine-5 methyltransferase 3B2

SCOPe Domain Sequences for d1khca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]}
teyqddkefgigdlvwgkikgfswwpamvvswkatskrqampgmrwvqwfgdgkfseisa
dklvalglfsqhfnlatfnklvsyrkamyhtlekarvragktfssspgesledqlkpmle
wahggfkptgieglkpn

SCOPe Domain Coordinates for d1khca_:

Click to download the PDB-style file with coordinates for d1khca_.
(The format of our PDB-style files is described here.)

Timeline for d1khca_: