Lineage for d1khba2 (1khb A:10-259)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404570Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 404571Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 404572Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 404573Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (1 species)
  7. 404574Species Human (Homo sapiens) [TaxId:9606] [69616] (6 PDB entries)
  8. 404575Domain d1khba2: 1khb A:10-259 [68607]
    Other proteins in same PDB: d1khba1
    complexed with act, edo, gto, mn

Details for d1khba2

PDB Entry: 1khb (more details), 1.85 Å

PDB Description: pepck complex with nonhydrolyzable gtp analog, native data

SCOP Domain Sequences for d1khba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khba2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens)}
nlsakvvqgsldslpqavreflennaelcqpdhihicdgseeengrllgqmeeegilrrl
kkydncwlaltdprdvariesktvivtqeqrdtvpipktglsqlgrwmseedfekafnar
fpgcmkgrtmyvipfsmgplgsplskigieltdspyvvasmrimtrmgtpvlealgdgef
vkclhsvgcplplqkplvnnwpcnpeltliahlpdrreiisfgsgyggnsllgkkcfalr
masrlakeeg

SCOP Domain Coordinates for d1khba2:

Click to download the PDB-style file with coordinates for d1khba2.
(The format of our PDB-style files is described here.)

Timeline for d1khba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1khba1