SCOPe 2.06: Domain d1kh0b_: 1kh0 B:

Lineage for d1kh0b_ (1kh0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1kh0b_: 1kh0 B: [68605]
   b1 domain; computer-designed conformation in the second turn

Details for d1kh0b_

PDB Entry: 1kh0, 1.9 Å

PDB Description: accurate computer base design of a new backbone conformation in the second turn of protein l

PDB Compounds: (B:) protein l

SCOPe Domain Sequences for d1kh0b_:

Sequence; same for both SEQRES and ATOM records:

>d1kh0b_ d.15.7.1 (B:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
eevtikanlifangstqtaefkgtkekalsevlayadtlkkdngewtidkrvtngviiln
ikfag

Timeline for d1kh0b_:

• d1kh0b_ first appeared in SCOP 1.59
  
• d1kh0b_ appears in SCOPe 2.05
  
• d1kh0b_ appears in SCOPe 2.07
  
• d1kh0b_ appears in the current release, SCOPe 2.08