Lineage for d1kgwa1 (1kgw A:404-496)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins) Protein Animal alpha-amylase [51024] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [51026] (13 PDB entries) 
Domain d1kgwa1: 1kgw A:404-496 [68600]
Other proteins in same PDB: d1kgwa2
Details for d1kgwa1
PDB Entry: 1kgw (more details), 2.1 Å
PDB Description: three dimensional structure analysis of the r337q variant of human pancreatic alpha-mylase
SCOP Domain Sequences for d1kgwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgwa1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
SCOP Domain Coordinates for d1kgwa1:
Click to download the PDB-style file with coordinates for d1kgwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kgwa1:
- d1kgwa1 is new in SCOP 1.59
- d1kgwa1 appears in SCOP 1.61
- d1kgwa1 appears in the current release, SCOPe 2.08
View in 3D
