Lineage for d1kgua1 (1kgu A:404-496)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302223Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 302224Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families) (S)
  5. 302225Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 302252Protein Animal alpha-amylase [51024] (3 species)
  7. 302253Species Human (Homo sapiens) [TaxId:9606] [51026] (18 PDB entries)
  8. 302266Domain d1kgua1: 1kgu A:404-496 [68598]
    Other proteins in same PDB: d1kgua2
    complexed with ca; mutant

Details for d1kgua1

PDB Entry: 1kgu (more details), 2 Å

PDB Description: three dimensional structure analysis of the r337a variant of human pancreatic alpha-amylase

SCOP Domain Sequences for d1kgua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1kgua1:

Click to download the PDB-style file with coordinates for d1kgua1.
(The format of our PDB-style files is described here.)

Timeline for d1kgua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgua2