Lineage for d1kgsa2 (1kgs A:2-123)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120209Superfamily c.23.1: CheY-like [52172] (3 families) (S)
  5. 120210Family c.23.1.1: CheY-related [52173] (9 proteins)
  6. 120285Protein PhoB receiver domain [52192] (2 species)
  7. 120289Species Thermotoga maritima [TaxId:243274] [69445] (1 PDB entry)
  8. 120290Domain d1kgsa2: 1kgs A:2-123 [68597]
    Other proteins in same PDB: d1kgsa1

Details for d1kgsa2

PDB Entry: 1kgs (more details), 1.5 Å

PDB Description: Crystal Structure at 1.50 A of an OmpR/PhoB Homolog from Thermotoga maritima

SCOP Domain Sequences for d1kgsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima}
nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirrk
se

SCOP Domain Coordinates for d1kgsa2:

Click to download the PDB-style file with coordinates for d1kgsa2.
(The format of our PDB-style files is described here.)

Timeline for d1kgsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgsa1