Lineage for d1kgsa1 (1kgs A:124-225)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723285Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1723286Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 1723292Protein PhoB [46898] (2 species)
  7. 1723301Species Thermotoga maritima [TaxId:2336] [68972] (1 PDB entry)
  8. 1723302Domain d1kgsa1: 1kgs A:124-225 [68596]
    Other proteins in same PDB: d1kgsa2
    complexed with scn

Details for d1kgsa1

PDB Entry: 1kgs (more details), 1.5 Å

PDB Description: Crystal Structure at 1.50 A of an OmpR/PhoB Homolog from Thermotoga maritima
PDB Compounds: (A:) DNA binding response regulator d

SCOPe Domain Sequences for d1kgsa1:

Sequence, based on SEQRES records: (download)

>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwsf
ddevfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde

Sequence, based on observed residues (ATOM records): (download)

>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}
skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwvf
sdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde

SCOPe Domain Coordinates for d1kgsa1:

Click to download the PDB-style file with coordinates for d1kgsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kgsa2