Lineage for d1kgob_ (1kgo B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96482Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 96483Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 96607Family a.25.1.2: Ribonucleotide reductase-like [47253] (4 proteins)
  6. 96683Protein Ribonucleotide reductase R2 [47257] (5 species)
  7. 96687Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (3 PDB entries)
  8. 96697Domain d1kgob_: 1kgo B: [68589]

Details for d1kgob_

PDB Entry: 1kgo (more details), 2.25 Å

PDB Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form

SCOP Domain Sequences for d1kgob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgob_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1kgob_:

Click to download the PDB-style file with coordinates for d1kgob_.
(The format of our PDB-style files is described here.)

Timeline for d1kgob_: