Class a: All alpha proteins [46456] (226 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins) |
Protein Ribonucleotide reductase R2 [47257] (8 species) |
Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (4 PDB entries) |
Domain d1kgnd_: 1kgn D: [68587] complexed with fe, of2, of3 |
PDB Entry: 1kgn (more details), 1.85 Å
SCOP Domain Sequences for d1kgnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kgnd_ a.25.1.2 (D:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes} sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
Timeline for d1kgnd_: