Lineage for d1kgnb_ (1kgn B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991247Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 1991260Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 1991266Domain d1kgnb_: 1kgn B: [68585]
    complexed with fe

Details for d1kgnb_

PDB Entry: 1kgn (more details), 1.85 Å

PDB Description: r2f from corynebacterium ammoniagenes in its oxidised, fe containing, form
PDB Compounds: (B:) Ribonucleotide reductase protein R2F

SCOPe Domain Sequences for d1kgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgnb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOPe Domain Coordinates for d1kgnb_:

Click to download the PDB-style file with coordinates for d1kgnb_.
(The format of our PDB-style files is described here.)

Timeline for d1kgnb_: