Lineage for d1kgnb_ (1kgn B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536385Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 536487Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 536500Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (4 PDB entries)
  8. 536502Domain d1kgnb_: 1kgn B: [68585]

Details for d1kgnb_

PDB Entry: 1kgn (more details), 1.85 Å

PDB Description: r2f from corynebacterium ammoniagenes in its oxidised, fe containing, form

SCOP Domain Sequences for d1kgnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kgnb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOP Domain Coordinates for d1kgnb_:

Click to download the PDB-style file with coordinates for d1kgnb_.
(The format of our PDB-style files is described here.)

Timeline for d1kgnb_: