Lineage for d1kgda_ (1kgd A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179248Protein Guanylate kinase-like domain of Cask [69474] (1 species)
  7. 179249Species Human (Homo sapiens) [TaxId:9606] [69475] (1 PDB entry)
  8. 179250Domain d1kgda_: 1kgd A: [68582]

Details for d1kgda_

PDB Entry: 1kgd (more details), 1.31 Å

PDB Description: Crystal Structure of the Guanylate Kinase-like Domain of Human CASK

SCOP Domain Sequences for d1kgda_:

Sequence, based on SEQRES records: (download)

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens)}
hmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppkkdeengknyyfvshdqm
mqdisnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfvvf
iaaptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc

Sequence, based on observed residues (ATOM records): (download)

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens)}
hmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppeengknyyfvshdqmmqd
isnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfvvfiaa
ptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc

SCOP Domain Coordinates for d1kgda_:

Click to download the PDB-style file with coordinates for d1kgda_.
(The format of our PDB-style files is described here.)

Timeline for d1kgda_: