Lineage for d1kgda_ (1kgd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109535Protein Guanylate kinase-like domain of Cask [69474] (1 species)
  7. 2109536Species Human (Homo sapiens) [TaxId:9606] [69475] (1 PDB entry)
  8. 2109537Domain d1kgda_: 1kgd A: [68582]
    complexed with fmt

Details for d1kgda_

PDB Entry: 1kgd (more details), 1.31 Å

PDB Description: Crystal Structure of the Guanylate Kinase-like Domain of Human CASK
PDB Compounds: (A:) peripheral plasma membrane cask

SCOPe Domain Sequences for d1kgda_:

Sequence, based on SEQRES records: (download)

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}
hmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppkkdeengknyyfvshdqm
mqdisnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfvvf
iaaptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc

Sequence, based on observed residues (ATOM records): (download)

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}
hmrktlvllgahgvgrrhikntlitkhpdrfaypiphttrppeengknyyfvshdqmmqd
isnneyleygshedamygtkletirkiheqgliaildvepqalkvlrtaefapfvvfiaa
ptitpglnedeslqrlqkesdilqrtyahyfdltiinneidetirhleeavelvc

SCOPe Domain Coordinates for d1kgda_:

Click to download the PDB-style file with coordinates for d1kgda_.
(The format of our PDB-style files is described here.)

Timeline for d1kgda_: