SCOP 1.73: Domain d1kfxs_: 1kfx S:

Lineage for d1kfxs_ (1kfx S:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47553] (2 PDB entries)

8. Domain d1kfxs_: 1kfx S: [68578]
   Other proteins in same PDB: d1kfxl1, d1kfxl2, d1kfxl3

Details for d1kfxs_

PDB Entry: 1kfx, 3.15 Å

PDB Description: Crystal Structure of Human m-Calpain Form I

PDB Compounds: (S:) m-calpain small subunit

SCOP Domain Sequences for d1kfxs_:

Sequence; same for both SEQRES and ATOM records:

>d1kfxs_ a.39.1.8 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
neseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynm
iirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

Timeline for d1kfxs_:

• d1kfxs_ first appeared in SCOP 1.59
  
• d1kfxs_ appears in SCOP 1.71
  
• d1kfxs_ appears in SCOP 1.75
  
• d1kfxs_ appears in the current release, SCOPe 2.08