Lineage for d1kfxs_ (1kfx S:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320686Family a.39.1.8: Penta-EF-hand proteins [63550] (7 protein domains)
  6. 2320700Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2320701Species Human (Homo sapiens) [TaxId:9606] [47553] (9 PDB entries)
  8. 2320716Domain d1kfxs_: 1kfx S: [68578]
    Other proteins in same PDB: d1kfxl1, d1kfxl2, d1kfxl3

Details for d1kfxs_

PDB Entry: 1kfx (more details), 3.15 Å

PDB Description: Crystal Structure of Human m-Calpain Form I
PDB Compounds: (S:) m-calpain small subunit

SCOPe Domain Sequences for d1kfxs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfxs_ a.39.1.8 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
neseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynm
iirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1kfxs_:

Click to download the PDB-style file with coordinates for d1kfxs_.
(The format of our PDB-style files is described here.)

Timeline for d1kfxs_: