Lineage for d1kfus_ (1kfu S:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152779Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 152792Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 152793Species Human (Homo sapiens) [TaxId:9606] [47553] (2 PDB entries)
  8. 152794Domain d1kfus_: 1kfu S: [68574]
    Other proteins in same PDB: d1kful1, d1kful2, d1kful3

Details for d1kfus_

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II

SCOP Domain Sequences for d1kfus_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfus_ a.39.1.7 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens)}
thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
tmys

SCOP Domain Coordinates for d1kfus_:

Click to download the PDB-style file with coordinates for d1kfus_.
(The format of our PDB-style files is described here.)

Timeline for d1kfus_: