Lineage for d1kfus_ (1kfu S:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins) 
Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [47553] (2 PDB entries) 
Domain d1kfus_: 1kfu S: [68574]
Other proteins in same PDB: d1kful1, d1kful2, d1kful3
Details for d1kfus_
PDB Entry: 1kfu (more details), 2.5 Å
PDB Description: Crystal Structure of Human m-Calpain Form II
SCOP Domain Sequences for d1kfus_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfus_ a.39.1.7 (S:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens)}
thysnieaneseevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtc
rsmvavmdsdttgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfh
lnehlynmiirrysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlql
tmys
SCOP Domain Coordinates for d1kfus_:
Click to download the PDB-style file with coordinates for d1kfus_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kfus_:
- d1kfus_ is new in SCOP 1.59
- d1kfus_ appears in SCOP 1.61
- d1kfus_ appears in the current release, SCOPe 2.08
View in 3D
