![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
![]() | Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
![]() | Species Human (Homo sapiens), M-type [TaxId:9606] [54042] (2 PDB entries) |
![]() | Domain d1kful3: 1kfu L:2-355 [68573] Other proteins in same PDB: d1kful1, d1kful2, d1kfus_ |
PDB Entry: 1kfu (more details), 2.5 Å
SCOPe Domain Sequences for d1kful3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kful3 d.3.1.3 (L:2-355) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), M-type [TaxId: 9606]} agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykk
Timeline for d1kful3: