Lineage for d1kful3 (1kfu L:2-355)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634471Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 1634472Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 1634478Species Human (Homo sapiens), M-type [TaxId:9606] [54042] (2 PDB entries)
  8. 1634479Domain d1kful3: 1kfu L:2-355 [68573]
    Other proteins in same PDB: d1kful1, d1kful2, d1kfus_

Details for d1kful3

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II
PDB Compounds: (L:) m-calpain large subunit

SCOPe Domain Sequences for d1kful3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kful3 d.3.1.3 (L:2-355) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), M-type [TaxId: 9606]}
agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs
iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc
pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykk

SCOPe Domain Coordinates for d1kful3:

Click to download the PDB-style file with coordinates for d1kful3.
(The format of our PDB-style files is described here.)

Timeline for d1kful3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfus_