Lineage for d1kful3 (1kfu L:2-355)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188207Fold d.3: Cysteine proteinases [54000] (1 superfamily)
  4. 188208Superfamily d.3.1: Cysteine proteinases [54001] (8 families) (S)
  5. 188357Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
  6. 188358Protein Calpain large subunit, catalytic domain (domain II) [54041] (3 species)
  7. 188359Species Human (Homo sapiens) [TaxId:9606] [54042] (2 PDB entries)
  8. 188360Domain d1kful3: 1kfu L:2-355 [68573]
    Other proteins in same PDB: d1kful1, d1kful2, d1kfus_

Details for d1kful3

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II

SCOP Domain Sequences for d1kful3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kful3 d.3.1.3 (L:2-355) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens)}
agiaaklakdreaaeglgsheraikylnqdyealrnecleagtlfqdpsfpaipsalgfk
elgpyssktrgmrwkrpteicadpqfiiggatrtdicqgalgdcwllaaiasltlneeil
arvvplnqsfqenyagifhfqfwqygewvevvvddrlptkdgellfvhsaegsefwsall
ekayakingcyealsggattegfedftggiaewyelkkpppnlfkiiqkalqkgsllgcs
iditsaadseaitfqklvkghaysvtgaeevesngslqklirirnpwgevewtgrwndnc
pswntidpeererltrrhedgefwmsfsdflrhysrleicnltpdtltsdtykk

SCOP Domain Coordinates for d1kful3:

Click to download the PDB-style file with coordinates for d1kful3.
(The format of our PDB-style files is described here.)

Timeline for d1kful3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfus_