SCOPe 2.04: Domain d1kful1: 1kfu L:515-700

Lineage for d1kful1 (1kfu L:515-700)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species)

7. Species Human (Homo sapiens), M-type [TaxId:9606] [47557] (2 PDB entries)

8. Domain d1kful1: 1kfu L:515-700 [68571]
   Other proteins in same PDB: d1kful2, d1kful3, d1kfus_

Details for d1kful1

PDB Entry: 1kfu, 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II

PDB Compounds: (L:) m-calpain large subunit

SCOPe Domain Sequences for d1kful1:

Sequence; same for both SEQRES and ATOM records:

>d1kful1 a.39.1.8 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens), M-type [TaxId: 9606]}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl

Timeline for d1kful1:

• d1kful1 first appeared in SCOP 1.59
  
• d1kful1 appears in SCOPe 2.03
  
• d1kful1 appears in SCOPe 2.05
  
• d1kful1 appears in the current release, SCOPe 2.08