Lineage for d1kful1 (1kfu L:515-700)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1490593Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 1490597Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species)
  7. 1490598Species Human (Homo sapiens), M-type [TaxId:9606] [47557] (2 PDB entries)
  8. 1490599Domain d1kful1: 1kfu L:515-700 [68571]
    Other proteins in same PDB: d1kful2, d1kful3, d1kfus_

Details for d1kful1

PDB Entry: 1kfu (more details), 2.5 Å

PDB Description: Crystal Structure of Human m-Calpain Form II
PDB Compounds: (L:) m-calpain large subunit

SCOPe Domain Sequences for d1kful1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kful1 a.39.1.8 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens), M-type [TaxId: 9606]}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl

SCOPe Domain Coordinates for d1kful1:

Click to download the PDB-style file with coordinates for d1kful1.
(The format of our PDB-style files is described here.)

Timeline for d1kful1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kfus_