| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
| Protein Calpain large subunit, C-terminal domain (domain IV) [47556] (3 species) |
| Species Human (Homo sapiens), M-type [TaxId:9606] [47557] (2 PDB entries) |
| Domain d1kful1: 1kfu L:515-700 [68571] Other proteins in same PDB: d1kful2, d1kful3, d1kfus_ |
PDB Entry: 1kfu (more details), 2.5 Å
SCOP Domain Sequences for d1kful1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kful1 a.39.1.8 (L:515-700) Calpain large subunit, C-terminal domain (domain IV) {Human (Homo sapiens), M-type [TaxId: 9606]}
eieanleefdiseddiddgvrrlfaqlagedaeisafelqtilrrvlakrqdiksdgfsi
etckimvdmldsdgsgklglkefyilwtkiqkyqkiyreidvdrsgtmnsyemrkaleea
gfkmpcqlhqvivarfaddqliidfdnfvrclvrletlfkifkqldpentgtieldlisw
lcfsvl
Timeline for d1kful1: