![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69605] (1 species) |
![]() | Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69606] (2 PDB entries) |
![]() | Domain d1kfqb3: 1kfq B:324-443 [68569] Other proteins in same PDB: d1kfqa4, d1kfqb4 complexed with ca |
PDB Entry: 1kfq (more details), 2.4 Å
SCOPe Domain Sequences for d1kfqb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfqb3 c.84.1.1 (B:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} tpsdslaviaananlifkngllgaarsmptsgaldkvaakngiklfetptgwkffgnlmd aglinlcgeesfgtgsnhirekdgiwavlawltilahknkntdhfvtveeivtqywqqfg
Timeline for d1kfqb3:
![]() Domains from other chains: (mouse over for more information) d1kfqa1, d1kfqa2, d1kfqa3, d1kfqa4 |