Lineage for d1kfqa3 (1kfq A:324-443)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876643Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 1876644Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 1876645Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 1876646Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69605] (1 species)
  7. 1876647Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69606] (2 PDB entries)
  8. 1876656Domain d1kfqa3: 1kfq A:324-443 [68565]
    Other proteins in same PDB: d1kfqa4, d1kfqb4
    complexed with ca

Details for d1kfqa3

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
PDB Compounds: (A:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqa3 c.84.1.1 (A:324-443) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
tpsdslaviaananlifkngllgaarsmptsgaldkvaakngiklfetptgwkffgnlmd
aglinlcgeesfgtgsnhirekdgiwavlawltilahknkntdhfvtveeivtqywqqfg

SCOPe Domain Coordinates for d1kfqa3:

Click to download the PDB-style file with coordinates for d1kfqa3.
(The format of our PDB-style files is described here.)

Timeline for d1kfqa3: