Lineage for d1kfia2 (1kfi A:206-323)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127595Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 127596Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 127597Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 127598Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69605] (1 species)
  7. 127599Species Paramecium tetraurelia [TaxId:5888] [69606] (2 PDB entries)
  8. 127601Domain d1kfia2: 1kfi A:206-323 [68556]
    Other proteins in same PDB: d1kfia4, d1kfib4

Details for d1kfia2

PDB Entry: 1kfi (more details), 2.4 Å

PDB Description: Crystal Structure of the Exocytosis-Sensitive Phosphoprotein, pp63/Parafusin (phosphoglucomutase) from Paramecium

SCOP Domain Sequences for d1kfia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfia2 c.84.1.1 (A:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia}
vqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgvagpyakhifgtllgcskesllncd
psedfggghpdpnltyahdlvelldihkkkdvgtvpqfgaacdgdadrnmilgrqffv

SCOP Domain Coordinates for d1kfia2:

Click to download the PDB-style file with coordinates for d1kfia2.
(The format of our PDB-style files is described here.)

Timeline for d1kfia2: