Lineage for d1kf3a_ (1kf3 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130218Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 130219Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 130220Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 130264Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 130265Species Cow (Bos taurus) [TaxId:9913] [54079] (110 PDB entries)
  8. 130268Domain d1kf3a_: 1kf3 A: [68550]

Details for d1kf3a_

PDB Entry: 1kf3 (more details), 1.05 Å

PDB Description: Atomic Resolution Structure of RNase A at pH 5.9

SCOP Domain Sequences for d1kf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf3a_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1kf3a_:

Click to download the PDB-style file with coordinates for d1kf3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kf3a_: