Lineage for d1keta_ (1ket A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118103Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (27 proteins)
  6. 118227Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (3 species)
  7. 118236Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (5 PDB entries)
  8. 118239Domain d1keta_: 1ket A: [68540]

Details for d1keta_

PDB Entry: 1ket (more details), 1.8 Å

PDB Description: The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with thymidine diphosphate bound

SCOP Domain Sequences for d1keta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keta_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2}
qfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvgd
iadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfhh
vstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgvk
atisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwailt
kgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrdel
gwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevik

SCOP Domain Coordinates for d1keta_:

Click to download the PDB-style file with coordinates for d1keta_.
(The format of our PDB-style files is described here.)

Timeline for d1keta_: