Lineage for d1keob_ (1keo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807135Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2807136Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2807137Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2807138Protein Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain [50913] (1 species)
  7. 2807139Species Cow (Bos taurus) [TaxId:9913] [50914] (12 PDB entries)
  8. 2807161Domain d1keob_: 1keo B: [68535]
    complexed with nag

Details for d1keob_

PDB Entry: 1keo (more details), 2.2 Å

PDB Description: twists and turns of the cd-mpr: ligand-bound versus ligand-free receptor
PDB Compounds: (B:) Cation-dependent mannose-6-phosphate receptor

SCOPe Domain Sequences for d1keob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keob_ b.64.1.1 (B:) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus) [TaxId: 9913]}
ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
tladnfnpvseergkvqdcfylfemdsslacs

SCOPe Domain Coordinates for d1keob_:

Click to download the PDB-style file with coordinates for d1keob_.
(The format of our PDB-style files is described here.)

Timeline for d1keob_: