Lineage for d1kekb5 (1kek B:669-785)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133320Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 133405Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (5 proteins)
  6. 133429Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain V [54889] (1 species)
  7. 133430Species Desulfovibrio africanus [TaxId:873] [54890] (3 PDB entries)
  8. 133432Domain d1kekb5: 1kek B:669-785 [68533]
    Other proteins in same PDB: d1keka1, d1keka2, d1keka3, d1keka4, d1kekb1, d1kekb2, d1kekb3, d1kekb4

Details for d1kekb5

PDB Entry: 1kek (more details), 1.9 Å

PDB Description: Crystal Structure of the Free Radical Intermediate of Pyruvate:Ferredoxin Oxidoreductase

SCOP Domain Sequences for d1kekb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kekb5 d.58.1.5 (B:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus}
tsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanftaleakg
kelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleyaarip

SCOP Domain Coordinates for d1kekb5:

Click to download the PDB-style file with coordinates for d1kekb5.
(The format of our PDB-style files is described here.)

Timeline for d1kekb5: